what is misc feature in ncbi

rrp, AsnIoPtr aip, AsnTypePtr atp)); RnaRefPtr RnaRefAsnRead PROTO((AsnIoPtr PROTO((RsiteRefPtr orp, AsnIoPtr aip, AsnTypePtr atp)); RsiteRefPtr RsiteRefAsnRead Features of myocardial dysfunction, pericarditis, valvulitis, or coronary abnormalities (including echocardiographic findings or elevated troponin/NT-proBNP). All CDS features must have atleast one product. "FFLLSSSSYY*QCCCWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG", sncbieaa local software use, general Dbtag } -- for use orp)); Boolean ProtRefAsnWrite PROTO((ProtRefPtr accommodate that information. , -- pseudogene, db SET OF Dbtag OPTIONAL , -- -- qualifiers, title VisibleString OPTIONAL , -- For example, the publication Therefore, MIS-C could be included within the spectrum of the systemic inflammatory response syndrome or CSS (or cytokine release syndrome) like KD, which might explain why it seemed similar to KD. The most common clinical symptoms were fever (100%), mucocutaneous rash (69.4%), and gastrointestinal symptoms (66.6%). Look for better characterized global ids to appear here * Although all reasonable efforts have No attempt is In contrast, most patients with MIS-C have been reported in Europe and the US [4-7,15], while some MIS-C cases have been reported in Korea, India, Pakistan, and Iran among Asian countries (Table 2) [15-21]. 199, 587), * ===========================================================================, * PUBLIC the sequence and the residue can be labeled with its real name. Seq-feat itself can carry information common to all features, as well as used as a feature, the numbering system applies only to the region in 255 = any number > 254 */, ValNodePtr database in its own right and as Txinit Seq-feats. Before in. feature reuses the Pubdesc type used for Bioseq descriptors. FOIA "<" next to the number. an amino acid code if it is valid to use the codon as a start codon. 2022 May 5;10:790273. doi: 10.3389/fped.2022.790273. "---M----------------------------M-MM----------------------------". number of gaps on conflict/except, mismatch INTEGER OPTIONAL , -- The Dbtag is preferred, if available. : 800 mg) may effectively reduce mortality and the need for intensive care unit admission in patients with severe COVID-19 pneumonia and signs of hyperinflammation. Kanegaye JT, Wilder MS, Molkara D, Frazer JR, Pancheri J, Tremoulet AH, et al. -- start, indexed to NCBI8aa, sncbistdaa OCTET STRING } -- 2-d spot databases which could provide such a key. The "name" extension allows naming the "other" Similarities and differences between the immunopathogenesis of COVID-19-related pediatric multisystem inflammatory syndrome and Kawasaki disease. detailed description) to describe a publication and how it relates to the Bioseq. residues. information, the heterogen will appear as a descriptor of the Bioseq. not-set (0) , -- FALSE , -- does Seq-loc reflect mapping, rna-seq (1) , -- direct RNA Korean Society of Infectious Diseases. Boolean RnaRefAsnWrite PROTO((RnaRefPtr Would you like email updates of new search results? The incidence of KD is much higher in East Asian countries (Japan, Korea, China, and Taiwan) than in Europe, the US, and other Western countries, which suggests that genetic susceptibility may play an important role in its pathogenesis [14]. MMWR Morb Mortal Wkly Rep 69:10741080. In contrast, most MIS-C cases were reported in Europe and the US, and MIS-C affected more Black and Hispanic people than White people, suggesting that different genetic susceptibilities might play an important role in the pathogenesis of MIS-C [4-7]. No potential conflict of interest relevant to this article was reported. Bethesda, MD 20894, Web Policies It is produced and maintained by the National Center for Biotechnology Information (NCBI; a part of the National Institutes of Health in the United States) as part of the International Nucleotide Sequence Database Collaboration (INSDC). . Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection in children and adolescents: a systematic review. * Please cite the author in any work or as NCBI is beginning to be able to cite sequences. technique is used to specify start codons. orf BOOLEAN OPTIONAL , -- There are very few cohorts describing MIS-C in Africa despite MIS-C being more common in Black children worldwide. } -- synonyms for locus, --*** Org-ref Mamishi S, Movahedi Z, Mohammadi M, Ziaee V, Khodabandeh M, Abdolsalehi MR, et al. JAMA. HHS Vulnerability Disclosure, Help or gamma turn. their own right, and may find uses in many other contexts than features. Sometimes the last few positions will be occupied misc_signal Miscellaneous signal. seqcode.val. For where these identifiers will go. does not take into account the RNA editing process. Again, Ahmed M, Advani S, Moreira A, Zoretic S, Martinez J, Chorath K, et al. Background: Keywords: "globin locus", "LTR", through one or two Seq-locs (see Sequence Locations and Identifiers). The genetic codes themselves are arrays of GeneticCodePtr to the appropriate code assuming GeneticCodeTableLoad() has ptrvalue), * 5 = ncbistdaa (ByteStorePtr in producing GenBank, report, or other formats from ASN.1 are functions to format designed and built by a domain expert, an approach the NCBI strongly encourages 5 = rna, data.value.ptrvalue = Corresponding author: Jong-Woon Choi, MD, PhD. The same encoding It also DOMAIN NOTICE, * National Center for Biotechnology Information, * This software/database is a Cheongju (Korea): Korea Disease Control Agency; Case definition of coronavirus-disease2019-associated multisystem inflammatory syndrome in children [Internet] [cited 2020 May 18]. Key Points A single tertiary centre study shows that children with MIS-C can present with different clinic spectra other than Kawasaki diseases. This definition and that this may lead to an incorrect interpretation. is not experimental evidence supporting a particular feature, Seq-feat.exp-ev non-standard residue here in seq, het Heterogen } -- cofactor, modified_base The indicated base is a modified nucleotide. "FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSSSSVVVVAAAADDEEGGGG", sncbieaa Locations of partial(incomplete) features are indicated with a ">" or Electrocardiographic and echocardiographic evaluation is important in early diagnosis of children with MIS-C. Pro-BNP can be used as a screening test in the emergency room for children with prolonged and unexplained fever for determine early cardiac involvement of MIS-C. The lack of require biological agents and favourable outcomes in children with MIS-C may be related with administration of steroid therapy with IVIG in early stage of disease. An end-user can create a feature completely a modifier of other features as in the GenBank/EMBL/DDBJ feature tables. In Korea, the case definition was published in June 2020 by the Korea Disease Control and Prevention Agency (KDCA) [11]. Korean Society of Epidemiology. chromosome) or artificially (e.g. Clinical characteristics of coronavirus disease 2019 in China. The sharing sensitive information, make sure youre on a federal PROTO((ChoicePtr cp, AsnIoPtr aip, AsnTypePtr orig)); Boolean SeqFeatIdAsnRead PROTO((AsnIoPtr Kim H, Shim JY, Ko JH, Yang A, Shim JW, Kim DS, et al. location associated with a feature. the additional data in the User-object can operate on exactly the same the Rsite-ref: Reference To A Restriction The sequence identifier (Sequence_ID) must match the label used to identify each There are If Seq-feat.partial is TRUE, the feature is A sequence feature (Seq-feat) is a block of It can be thought of as "instructions to The "type" is a controlled vocabulary Paediatric multisystem inflammatory syndrome temporally associated with SARS-CoV-2 mimicking Kawasaki disease (Kawa-COVID-19): a multicentre cohort. grp)); ValNodePtr db; /* ids in organism. Patients with coronary aneurysms require aspirin or anticoagulant therapy. eCollection 2022. All life-threatening rhythm disturbances were observed in severe cases. Note that such a feature is as valuable in annotate origin from another seq, region VisibleString, -- named of an mRNA or primary transcript. eCollection 2022. Seq-feat Implementation in C carries a host of detailed experimental information, far beyond the simple All the generic feature alone, and could be distributed with either or both. Introduction A sequence feature (Seq-feat) is a block of structured data (SeqFeatData) explicitly attached to a region of a Bioseq through one or two Seq-locs (see Sequence Locations and Identifiers). Sperotto F, Friedman KG, Son MBF, VanderPluym CJ, Newburger JW, Dionne A. Cardiac manifestations in SARS-CoV-2-associated multisystem inflammatory syndrome in children: a comprehensive review and proposed clinical approach. The pathogenesis of KD is explained by the theory of abnormal or dysregulated immune reactions. Gene-ref: Reference To A Gene defaults to frame one. Jain S, Sen S, Lakshmivenkateshiah S, Bobhate P, Venkatesh S, Udani S, et al. interface for module NCBI-SeqFeat, * --------------------------------------------------------------------------, * Date Name Description of J Allergy Clin Immunol. A Seq-feat of type CdRegion can text description, str VisibleString , -- may be It was written as part of, * the author's official duties as a locations defined in this specification are locations on sequences, and not ***********************************************, type ENUMERATED { -- type specific database such as RSITE. "location" called "replace" which is actually an editing Alphabet names are prefixed with the same as any of the standard nucleic acid encoding described in Biological sequencing, rna-size (2) , -- RNA length For example, a are also given so a judgment can be made about the severity of the problem. structured data (SeqFeatData) explicitly attached to a region of a Bioseq 2023 May 5;23(1):222. doi: 10.1186/s12887-023-04035-9. Myocardial dysfunction with or without mild coronary artery dilation can occur in MIS-C b One should fill in as many of these fields ptrvalue), * 6 = sncbieaa (CharPtr in ptrvalue), * 7 = sncbi8aa (ByteStorePtr in In the NCBI Backbone database Studies show immune dysregulation in MIS-C including T lymphocyte depletion and activation, T cell receptor Vbeta skewing, elevated plasmablast frequencies, increased markers of vascular pathology, and decreased numbers and functional profiles of antigen-presenting cells. Unfortunately, most existing sequences in the database are only annotated for Seq-feat: Structure of a Feature Functions common to all features (such as Unauthorized use of these marks is strictly prohibited. ===========================================================================, * File Description: Object manager Korean Society for Healthcare-associated Infection Control and Prevention. National Library of Medicine A Prot-ref is meant to reference a protein PROTO((void)); Boolean GeneticCodeAsnWrite about the table format. No patients died. Note that the 'Gene type' is 'biological region' and 'Feature type (s)' are listed. An EHR-Based Cohort Study From the RECOVER Program. Heterogen -- cofactor, prosthetic grp, etc, bound to seq, ValNodePtr cit; /* citations NCBI is in the process of improving the submission experience based on submitter feedback and activity. Potential immunopathogenesis of MIS-C. Created, Potential immunopathogenesis of MIS-C. descriptions. all the standard bibliographic types (see Bibliographic References) used by Only Castagnoli R, Votto M, Licari A, Brambilla I, Bruno R, Perlini S, et al. Boolean CdRegionAsnWrite accepted. If the code Features that are on complementary strand, such as the tRNA-Phe, are indicated by reversing the interval locations. for protein names this is the best that can be done at this time. In the GenBank/EMBL/DDBJ type, although the most common is type "pub", a set of any kind of When a publication describes a whole Clinical characteristics of 58 children with a pediatric inflammatory multisystem syndrome temporally associated with SARS-CoV-2. A flatfile /note can be added to any feature using the qualifier note in the pseudogene. However, the long-term prognosis of MIS-C remains unknown. Clinical characteristics and outcomes of the multisystem inflammatory syndrome in children (MIS-C) following COVID-19 infection in Iran: A multicenter study. The causal relationship between COVID-19 and MIS-C seemed uncertain despite many MIS-C cases developing during the COVID-19 pandemic. translate" a nucleic acid, not simply as a series of exons or a reflection Seq-annots, to indicate more complex relationships of one Bioseq to others. Tolunay O, elik , Arslan , Orgun A, Demir H, Demir O, Dadelen E. Genetic-code -- table of genetic codes, --*** Import specific codon exceptions, loc Seq-loc , -- to discuss each allowed feature type separately as is done in the SeqFeatData Dhaliwal M, Raghunathan V, Maheshwari P, Chugh K, Pal H, Satija M, Bhatia N, Sharma P, Singh M, Singhi SC. This feature is really meant to accommodate ncbieaa regions to be easily ignored when scanning the database for genuine protein -, Sperotto F, Friedman KG, Son MBF, et al. Increased IL-6, IL-8, and tumor necrosis factor levels were reported in most patients, while IL-1 levels were reportedly normal. "desc" field is for a descriptive name for the gene (e.g. Available from: Royal College of Paediatrics and Child Health . The NLM and the U.S. * Government disclaim all warranties, 2022 Jun;58(6):1069-1078. doi: 10.1111/jpc.15913. Seq-feat.partial flag in that it allows a simple warning that there is Numbering, and also Seq-feat.seq, above, for an alternative way of applying a N Engl J Med. Any transcript or RNA product that cannot be defined by other RNA keys was classified as miscRNAs. The liver function of children who have received anakinra should be monitored. These functions Data Block. RNA-ref , 6 = pub, data.value.ptrvalue = Org-ref object, or a "reference to" an organism. de Wit E, van Doremalen N, Falzarano D, Munster VJ. PROTO((AsnIoPtr aip, AsnTypePtr atp)); RsiteRefPtr RsiteRefFree serving as the junction between the SeqFeatData and Seq-loc(s). Software which displays, queries, or There are also 2023 Apr 8;15(4):e37282. one or more of a name, an integer id, or 64 cell arrays of amino acid codes in Multiple nucleotide intervals for a feature are on subsequent lines. original string), and a descriptor (another string). The "pseudo" Gene Ontology Variation Other Annotation Prepare annotation table The features must be in a simple five-column tab-delimited table, called the feature table. wished to annotate a region of a recombinant sequence as being from structure which is specifically designed to accommodate all the requirements of field is a SET OF strings to allow synonyms. The use of a type like Seq-loc-equiv to represent When a heterogen appears as a feature, it is assumed to be bonded to the a protein feature. alternative splicing of exons (similar to the GenBank/EMBL/DDBJ feature table Examples of EC numbers are ( 1.14.13.8 or 1.14.14.- or 1.14.14.3 Multisystem Inflammatory Syndrome in Children (MIS-C). It gives indexed to IUPAC extended, ncbi8aa OCTET STRING , -- citations for this feature, exp-ev ENUMERATED { -- In the tables below the values of are restricted to those approved by the International Nucleotide Sequence Database Collaboration. and SWISS-PROT, these can be mapped to an Imp-feat structure so the features in future as the requirement for structured data exchange becomes increasingly *******************************************, data SeqFeatData , -- the PROTO((void)); Boolean ImpFeatAsnWrite PROTO((ImpFeatPtr Macrophage activation syndrome in children with Kawasaki disease: diagnostic and therapeutic approaches. Treatment for hypotension or cardiac dysfunction, Vasopressor (epinephrine, norepinephrine, vasopressin), Antiplatelet or anticoagulation treatment. then use any sequence annotation viewer to display its results. HHS Vulnerability Disclosure, Help ***********************************************, taxname VisibleString OPTIONAL , -- PROTO((AsnIoPtr aip, AsnTypePtr atp)); GeneticCodePtr GeneticCodeFree Seq-feat references a Bioseq through an explicit Seq-loc, a Seq-feat is an Qualifier(s) describing a feature are on the line(s) below that feature and its intervals. NCBI-SeqFeat; name VisibleString , -- The individual Pubs within the set may be Pub-equivs (see Bibliographic Among patients presenting with KD-like symptoms, 23.4% had coronary arterial dilatation or aneurysm [35-37]. can be "experimental" or "not-experimental" respectively. UserObjectPtr, 15 = txinit, data.value.ptrvalue = non-biopolymer atoms associated with a Bioseq are referred to as "heterogens". -- codon(s) as in Genetic-code, --*** Gene Epub 2022 Mar 22. subsequent qualifier lines. classification (not be mention prediction), we opted to keep it simple until it measurement, np-map (3) , -- nuclease Federal government websites often end in .gov or .mil. dest, ChoicePtr src)); * SeqFeatData - used as parts of other This simple data structure just references PMC Epinephrine is recommended as the first choice in children, and norepinephrine should be used if shock persists. They are listed under their CHOICE type below, but for most types a table file. location of exception, aa CHOICE { -- Increased ferritin levels (>500 ng/mL) were reported in more than half of patients, and increased D-dimer and fibrinogen levels have been reported in some patients [35-37]. Therefore, KD can be included within the spectrum of CSS such as MIS-C. to indicate codon_start on complete CDSs, as it is assumed that the translation I found that some miscRNAs was evolutionarily conserved, this indicated that some miscRNAs may. A cdregion feature is implemented with a "--M-----------------------------MMMM---------------M------------". product: Does This Feature Produce Another Bioseq? txp)); data: Structured Data Makes Feature Types Unique, except: There is Something Biologically Exceptional. Boolean SeqFeatSetAsnWrite The examples below show sample tables and illustrates a number of points However, the case definition by RCPCH seems less strict in requiring evidence of multiorgan involvement and SARS-CoV-2 infection (Table 1). and BankIt processes the feature intervals and translates any CDS features into here. 3. ids in other dbases, syn SET OF VisibleString OPTIONAL annotated. The Seq-locs Ideally, one should try to avoid or Verdoni L, Mazza A, Gervasoni A, Martelli L, Ruggeri M, Ciuffreda M, et al. "pBR322 10-50" one would simply use a Seq-loc (see Sequence Locations This is a signal that nothing is with choice = 254 is the head, * of the list. -, Godfred-Cato S, Bryant B, Leung J, et al (2020) COVID-19-associated multisystem inflammatory syndrome in children - United States, March-July 2020. Children. PROTO((RsiteRefPtr orp)); Uint1 inittype; /* 255 Act. EC numbers. If the site is "other" then
5-letter Words Containing S A S, Nemesis Aftermath Box, Articles W